PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009611399.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 172aa    MW: 20010.5 Da    PI: 8.3333
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009611399.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.72.3e-191569256
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    +++ ++t++q++ Le  F++n++++ +++ +LA++lgL+ rqV +W+qN+Ra++k
  XP_009611399.1 15 CHKKRLTQDQVRLLEISFNSNNKLDSNRKSQLAQELGLPPRQVAIWYQNKRARWK 69
                    567789************************************************9 PP

2HD-ZIP_I/II112.72.3e-3616107293
     HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     +k+rl+++qv+lLE sF++++kL+++rK++la+eLgl prqva+W+qn+RAR+k++ lE+dy+aL++++d+ + +nerL+ eve+L+eel++
  XP_009611399.1  16 HKKRLTQDQVRLLEISFNSNNKLDSNRKSQLAQELGLPPRQVAIWYQNKRARWKSQSLEVDYKALQQRLDNAMLDNERLKLEVERLKEELNK 107
                     69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.1631171IPR001356Homeobox domain
SMARTSM003894.5E-171475IPR001356Homeobox domain
PfamPF000461.3E-161669IPR001356Homeobox domain
SuperFamilySSF466891.31E-171680IPR009057Homeodomain-like
CDDcd000861.04E-141672No hitNo description
Gene3DG3DSA:1.10.10.602.2E-191878IPR009057Homeodomain-like
PRINTSPR000315.6E-64251IPR000047Helix-turn-helix motif
PROSITE patternPS0002704669IPR017970Homeobox, conserved site
PRINTSPR000315.6E-65167IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009637Biological Processresponse to blue light
GO:0009646Biological Processresponse to absence of light
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MDFFNSQTRK NNLKCHKKRL TQDQVRLLEI SFNSNNKLDS NRKSQLAQEL GLPPRQVAIW  60
YQNKRARWKS QSLEVDYKAL QQRLDNAMLD NERLKLEVER LKEELNKAQE MLLAFNTTTN  120
NYSSISSSCD EVGSSCLQLH DQSKHHLDKE LYACLIGDEG HFGHNFFASS MS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1818RKNNLKCHKKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009611399.11e-125PREDICTED: homeobox-leucine zipper protein ATHB-52-like
TrEMBLM1D4I81e-105M1D4I8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000812961e-104(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27152453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53980.14e-25homeobox protein 52